PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 225aa    MW: 24338.7 Da    PI: 6.0244
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17036.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB165.66.5e-5243138297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+t+ea+d+cqre+rkt++++d+lwa+a+lGf+dyvepl+++l+++re e+++
  PK17036.1  43 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITGEANDRCQREQRKTVTAEDVLWAMAKLGFDDYVEPLTLFLTRHRESETDR 138
                89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.7E-4837149IPR009072Histone-fold
SuperFamilySSF471133.11E-3645154IPR009072Histone-fold
PfamPF008083.1E-2548112IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-157694No hitNo description
PROSITE patternPS0068507995IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-1595113No hitNo description
PRINTSPR006151.8E-15114132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
GLVVTNNTNE ENGIGAGTDN NGAGAFTGGG GGHERVQNTC VIREQDQYMP IANVIRIMRR  60
ILPSHAKISD DAKETIQECV SEYISFITGE ANDRCQREQR KTVTAEDVLW AMAKLGFDDY  120
VEPLTLFLTR HRESETDRSS SSLRPEPAYV KRNSSANMDH YGPSHHLHVG PYGPGGPGYQ  180
LGPYPPAMFE NSIHGYFRDG SGHTGPGSGA GSSGGGGYDP FGQYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3843133393NF-YB
4awl_B2e-3843133494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3843133494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088443.12e-79Nuclear transcription factor Y subunit B-9
SwissprotQ9SFD81e-66NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLW9R1D42e-79W9R1D4_9R
STRINGVIT_00s0956g00020.t011e-64(Vitis vinifera)
STRINGAT1G21970.13e-64(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-67NF-YB family protein